PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn215801
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HB-other
Protein Properties Length: 1368aa    MW: 152090 Da    PI: 8.5158
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn215801genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.51.7e-1149862057
                HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox 20 eknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                +k++yps+e++ + A+++gLte+qV+ WF+ rR k+k+
  Achn215801 49 QKHKYPSEEMKSQFAESVGLTEKQVSGWFCHRRLKDKR 86
                579*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.4E-43991IPR001356Homeobox domain
PROSITE profilePS5007112.5684887IPR001356Homeobox domain
CDDcd000866.05E-94987No hitNo description
SuperFamilySSF466898.98E-104993IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-114986IPR009057Homeodomain-like
PfamPF000465.2E-94986IPR001356Homeobox domain
Gene3DG3DSA:2.30.29.307.9E-34538657IPR011993PH domain-like
CDDcd133657.80E-43540653No hitNo description
SuperFamilySSF507296.02E-21541652IPR011993PH domain-like
Gene3DG3DSA:2.130.10.303.4E-827611083IPR009091Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II
SuperFamilySSF509851.11E-797721084IPR009091Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II
PROSITE patternPS006260776786IPR000408Regulator of chromosome condensation, RCC1
PROSITE profilePS5001211.429790862IPR000408Regulator of chromosome condensation, RCC1
PfamPF004151.0E-5791833IPR000408Regulator of chromosome condensation, RCC1
PROSITE patternPS006260849859IPR000408Regulator of chromosome condensation, RCC1
PfamPF004157.7E-12862911IPR000408Regulator of chromosome condensation, RCC1
PROSITE profilePS5001212.594863914IPR000408Regulator of chromosome condensation, RCC1
PRINTSPR006332.2E-8864880IPR000408Regulator of chromosome condensation, RCC1
PRINTSPR006332.2E-8898911IPR000408Regulator of chromosome condensation, RCC1
PROSITE patternPS006260901911IPR000408Regulator of chromosome condensation, RCC1
PfamPF004153.8E-13927975IPR000408Regulator of chromosome condensation, RCC1
PROSITE profilePS5001215.107927978IPR000408Regulator of chromosome condensation, RCC1
PfamPF004155.0E-79781027IPR000408Regulator of chromosome condensation, RCC1
PROSITE profilePS5001213.1979791030IPR000408Regulator of chromosome condensation, RCC1
PRINTSPR006332.2E-810171033IPR000408Regulator of chromosome condensation, RCC1
PROSITE profilePS5001214.64510311082IPR000408Regulator of chromosome condensation, RCC1
PfamPF004152.3E-1410321079IPR000408Regulator of chromosome condensation, RCC1
PRINTSPR006332.2E-810331047IPR000408Regulator of chromosome condensation, RCC1
PfamPF137137.0E-1811771211IPR027988Transcription factor BREVIS RADIX, N-terminal domain
PfamPF166272.9E-2312181287No hitNo description
PfamPF083811.2E-2712941348IPR013591Brevis radix (BRX) domain
PROSITE profilePS5151431.56112941349IPR013591Brevis radix (BRX) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1368 aa     Download sequence    Send to blast
MHEVQRSKAG EPQYNSEASC WSSMNLRLLH PRMEIRNQAR KWSEAKPLQK HKYPSEEMKS  60
QFAESVGLTE KQVSGWFCHR RLKDKRSLYV EASANGRQDH SSGIIQDRGS GLKQDSCGST  120
KQGDNRHDPR EVESRRFSGQ DFSAANLAYE HDCHHNRNYN DMDDTSSGSS LPLQHSFLRQ  180
RENHFDVVTP RYVLKNENIE QINLMGLRTR TGPSGYLKVK SKVENAAVTT VKRQLGRHYC  240
EDGPQLGVEF DLLPPGAFES STREPDNEPH YIGDASPLYS TDVPGIHNKN NSCTKYEAYS  300
SKMSLHTPDL DDTSFKIMHG FDHHENSISR RSKPMPLLPN HGNPFPGRKS SLDTKEVSTG  360
EISVYDGSRP YKMRANHDIE GGMRMDYISS RRMPPYDRKV TGGQRESWLC KSDDVSLADA  420
QIEHVKAENS NKTLMYGEYL EMEDRGLSRR MTKVAKRDQD EFLWQQYARK ASIAEPRPWT  480
KQIKSSLIRS DFLEFQFLYG NLIDEETSEL MFLLTILPFS LRTILELNWY GHLTHRASSH  540
AITALKKGAC LLKYGRRGRP KFCPFRLAND ESVLIWFSGK EEKHLKLSHV SRIISGQRTQ  600
IFQRYPQPEK EYQSFSLIYN HRSLDLNSSF PVQICKDKDE ADKWFSGLKA IISRGHQRKW  660
RTESRSDGIP SEANSPQTYT QRSSPLNSPF GSGDSLQKDD GDQLRLHSPY ESPPKNGLDK  720
AFSDVILHAV PPKSFFPSES VSGSVHSLIE SCFGVKMDSL LPKSLKAAVV LDVQNMACGG  780
RHAALVTKQE EIFSWGEESG GRLGHGVDSD VLRPKLIDSL SHTSIELVAC GHGNEVMNWP  840
LEDIHVSSIS CGPWHTAVVT SSGQLFTFGD GTFGVLGHGD RRSVSKPREV ESLKGLRTVR  900
AACGVWHTAA VVEVMVGSSS SSNCSLGKLF TWGDGDKGRL GHGDRESKLV PTCVAALVEP  960
NFCKVSCGHS LTVALTSSGH VYTMGSPVYG QLGNPQADGK LPIRVEGKLS KSFVEEIACG  1020
AYHVAVLTSR TEVYTWGKGT NGRLGHGDTH DRSSPTLVEA LKDKQVKSIA CGTNFTTAIC  1080
LHKWVSGIDH SLCSGSTSPI SRRASPPRSA TPIPTLGGFA SPKLNVEDTM RPNDSLSREV  1140
ITLRAQVENL SRKAQIQELE LGRTSKQLKE AITIAGEETA KCKAAKEVIK SLTAQLKDMA  1200
ERLPMGAVQN IKPPSIISFG SNPISHEVSN ACVDRLSGQI TFQASDANGS NGQLISNGSS  1260
IASNHSSGNT RQGQSETTTR NGSKMRESDS HNDNEQVEQD DPGVYITLTS LPGGSKDLKR  1320
VRFSRKRFSE KQAEQWWAEN RARVYERYNV RMVDKSSVGV GSEDFMH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kci_A2e-45762110218383Probable E3 ubiquitin-protein ligase HERC2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012472921.10.0PREDICTED: uncharacterized protein LOC105790067 isoform X1
TrEMBLA0A0D2P5360.0A0A0D2P536_G
STRINGGSMUA_Achr5P08220_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34362242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.19e-58HB-other family protein